Sequence of Novel Peptides Ensembl Browser Links
AAAAAADGEPSSPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:1441274-1442515
AAAAAAPLPVAPPPDTPPLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:24541185-24544156
AAAATADTGGPTLFDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:27656815-27658641
AAAATADTGGPTLFDKLLAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:27656815-27658641
AAASAAAEGGSPEPLEVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:30914720-30919385
AAATEAAADAALPLHPSSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:5588034-5589308
AAAVTTRWNSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:17834391-17834942
AACLHPLCVSPGSSLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:15630122-15631141
AADELQDEDPTVAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:1049242-1059479
AADVADYAVGVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:10257623-10267975
AAEDAFLDLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24428169-24435680
AAEETWGANR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38930834-38934851
AAELTTLLESR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4728370-4729899
AAELVHVACR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:11264268-11281448
AAENVYLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22703461-22704919
AAFGPGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:20453930-20454298
AAFKLSEEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26071308-26072170
AAGADVVGGDELLEELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:20666359-20673326
AAGFDLNVLVADAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:29559810-29566365
AALADYFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:17007027-17010559
AALDLAALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:27728863-27733712
AALELGYSFASGDSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
AALPYNEETFDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:3336207-3342883
AALQDLLFDAETK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:9123797-9124112
AANLKPDPDLDVYMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:18128805-18137146
AAPALAKPTTPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:1249997-1251234
AAPAVLTSVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:8800800-8805082
AAPLSLPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:17058459-17059328
AAQQSALAEAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:32328176-32332787
AASGEDKQSVVEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:21607199-21616747
AASPSSGAGAGAGAGSDPTPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:13144940-13149564
AASQLTGSSSLVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:22763919-22768860
AATSSTSTGTVPSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:25002748-25006618
AAVEEQHLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:27406953-27407753
ACLPPTTSPPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:33890339-33891727
ACQLEDGDLVCFQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:3412801-3424024
ADENPSVEKPNGLSEEVVCSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:19425284-19427528
ADLLLAFGVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:18236024-18238051
ADLPLLLVFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:25033513-25041514
ADLVHSAANLLDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:410412-418150
ADNADGVPEVNVVALSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:20778421-20786524
ADPFVVLYLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:12331909-12335361
ADSSVPQQSRPQEPSTSTPSVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:14531163-14547557
ADVFADLGSPVSPLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24460998-24462763
AEAAPASPTASVPGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:26553436-26563364
AEAHLYTLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:18334633-18348718
AEAHLYTLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:18334633-18348718
AEAHLYTLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:18334633-18348718
AEAMAFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38055909-38057936
AECSVTSEWSPDGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:23749418-23753207
AEDAVAAEGEADGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:29292718-29302740
AEDEAAYESVGDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:27826397-27839127
AEDGAAAPSVASFVEEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
AEDRPDGESSTASSTDMDLDSSAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
AEELVLQPLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:1815942-1819529
AEGVEQPQLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:6736007-6737669
AEKKEYDESDLAYLQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28639834-28641377
AEPLDDSEEAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21324959-21327652
AEQLTWTSLDYDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
AESEGEAAENTEAQDADAGLSLPFSER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:39445-47162
AESPTASSLYGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:31013587-31021346
AFFANMPLSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:26933428-26950921
AFLGSVSDYLVHHACCPVLVVKPTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:30902126-30902819
AFLSAAAASPPTLLPADAAPVASR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:28699866-28705397
AFMTADLPHELLELLEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:234253-243999
AFQLNFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:21062109-21062474
AFTFQDSAGLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
AFVPAVLLGEAEPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:25273660-25283257
AGAVSVVVVHAQHGPDHFVYPVAAHAALAYAPASALESMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:30902126-30902819
AGAVSVVVVHAQHGPDHFVYPVAAHALAYAPASALESMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:30902126-30902819
AGAWRNSPHSSGAEWR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:18668711-18669625
AGEAASNLSDLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21595427-21597470
AGKLNMSLQRTLVLDSLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21993451-21993767
AGLAASHTQQVLVEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
AGLTEELLQEQLEQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:2397130-2397764
AGRPGGDAHASESGTGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:42303783-42311180
AGVAANVPVVGLTTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22555812-22557590
AHSVAVSAGDTEAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:27358148-27361057
ALAAQAAAAAAEEEHNNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:32788545-32792599
ALADPNVDVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
ALAHFHFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:16766384-16771956
ALALVVPSVVVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29483745-29495476
ALAMMPGVYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
ALAVDEFAGLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:42303783-42311180
ALCLAALEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1978364-1982502
ALDVNNSSPGLEPFNALSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:35347466-35355894
ALDVNNSSPGLEPFNALSKEEYEDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:35347466-35355894
ALEEVHDLTTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
ALELDPSMHK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
ALFEAALSMTEQGVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:18153473-18160108
ALFVQADGVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:21818774-21822028
ALGEQVSNGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
ALGLSVEADK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:1815942-1819529
ALGLSVEADKVAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:1815942-1819529
ALGVDLLSGFGALVGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:3313744-3319873
ALGVELNKQVGNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:17184665-17185645
ALLQTDGQLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28091491-28102058
ALLSAEMAGLDLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:27728863-27733712
ALLSTLNPELLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4728370-4729899
ALMSLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:12365598-12374781
ALNLQLASLVCSGLQPLHNLTVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:21410979-21413714
ALPTAAASTLTLLDLQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:15410405-15419017
ALQHYTELPDLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
ALQHYTELPDLKR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
ALQLLAMATPEDLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
ALSAPLDTPPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21324959-21327652
ALSEGGFDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:17464010-17464995
ALTDANYYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:17551534-17556429
ALTDSLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22521666-22535111
ALVDTFLMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:28699866-28705397
ALVLSDWSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:2310371-2315159
ALWDEEMDNSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22521666-22535111
ALYDQFGEEGLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:1553502-1557050
AMELVYNDEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
AMLLAAALQHK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:33758358-33764268
AMLTQMLSLVFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
AMSSEQLAELAALDPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:28780146-28783811
ANADTPADALTAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:18153473-18160108
ANEAGETVTSLSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:2398336-2399776
ANGGAVAGGLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:4250233-4254697
ANKMFVDYNEPQTER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
ANLVTFVYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:12330639-12330749
ANPDNNSVLGFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38619498-38623839
ANQFLVASSLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
ANSDSNLPCHLTPCN http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:110727-112210
ANSLQELDDMLAMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25461489-25467830
ANSQNFPLLNLLQMSATR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
ANVDALNNFTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1754864-1781910
APAATLPPNPEAASPGSAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:387579-393979
APASALESMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:30902126-30902819
APDSPNPMPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33740534-33742085
APFLVQER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:6401741-6411992
APPPPPPAPAPAPPSSSSAAAAPGRSPAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:27676311-27677216
APSPEVVER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:1441274-1442515
AQAEAAGGGDKEAVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:1734130-1735209
AQASSSYTSSSLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11273881-11284496
AQLGAVAPAVER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
AQQDEASDQPEHA http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:8629928-8634596
AQQVSGVEAAAGTPAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:19542049-19545414
AQTVAQYQLDLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:23147353-23151470
AQVQLPLEVVNLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:697818-708175
AQVVPVAEGAAVEGDSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:13103345-13114969
AQVVSNLNACTVVADTVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
ASDEEKYDLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
ASDPLLEDGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:17067271-17070817
ASEEQVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26071308-26072170
ASELLEQTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
ASFLEEDEEMEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:27358148-27361057
ASGVAYQVGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:3526768-3529963
ASGVAYQVGKFPLLANSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:3526768-3529963
ASHPNYELETR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:11025839-11038841
ASLDASDAGFSSGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:25528317-25536584
ASLSEGGNLNYQDTQTTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:26712980-26715839
ASPPPPSTAGSAPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:9067835-9071357
ASQLEDGDLLCFQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:21501179-21516492
ASQPTDTTTSPLAGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21230453-21235121
ASTVEQLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:8540496-8540831
ATEASPASVEELQSLAGGADLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
ATELVFADK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
ATGAVCAVLGSFSGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1978364-1982502
ATHAELVAALER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:21884809-21903793
ATKVMFER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21595427-21597470
ATLELGLAHR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:5780907-5788967
ATLLSAAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:17392210-17392483
ATLRENSAELER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
ATNPSRLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:25543329-25548488
ATPRDPFVVATVTGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:34730945-34731442
ATSDSQVLTTLTTEDLGVSGLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:29770484-29773362
ATSFEVLSTLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:29292718-29302740
ATVLGFSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22521666-22535111
AVAALSAGNDDFVGTMLAEALDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:36281081-36284814
AVAMSATDGLMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:20972801-20973037
AVANLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38286493-38287287
AVAVTPEESK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
AVAYGVGLALAAHLLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21595427-21597470
AVDVVQAQDLEQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:18611527-18612369
AVEGSDFLLTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:24416539-24426189
AVEYFELSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:697818-708175
AVFLSLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:6806336-6806875
AVGLGAYLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11273881-11284496
AVGPVMDASFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:14724546-14731250
AVGTMLSHEVTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:27622638-27636124
AVLAANALDFASPGAANR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:5559983-5562827
AVLDASQSNNTSWER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:2905031-2912761
AVLQQDLATFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25593687-25596516
AVSNALYFLLPAGELVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:5002959-5008060
AVSVFNASAVGAGLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:28005411-28012430
AVTDNLGYYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:11025839-11038841
AVTSYLSSSPSTPESPVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
AWQLLDKLPGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25495638-25496147
AYDDQDTDSAQSGAPTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
AYKETFTLTFVTGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11273881-11284496
AYYFGYLLHR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:25033513-25041514
CCDEVDPLAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21230453-21235121
CGNNAPALK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:39639691-39639941
CGYESPTPVQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:23805422-23810665
CLADDPYAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
CQLAVASYDAHGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
CVVPLAAALSPVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:14014748-14022165
DAGEDAQEQMSSGGENEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:8808952-8812491
DALEEQGYTEGELEER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:30842711-30845773
DALEQQLLEVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:31188628-31195903
DANSPQVTGNNLLLAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:28324780-28333589
DAPPAVAAPGPGLYFELGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:29770484-29773362
DATLVYTDLFPLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:12742141-12745304
DATMHVSDGALHGYDSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
DDDLTTQLGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:3412801-3424024
DDFLAMLEESK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:19178864-19191229
DDLLSTVTNNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:28173583-28176896
DDTLLDFYNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:28173583-28176896
DEAALALAQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:21884809-21903793
DEANLVLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:2340595-2341946
DEPDAPLPPAVDGLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:25091895-25097997
DFGGEEMNGFQGGYGGGGGSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:26464358-26466966
DFLQDLGEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:10058032-10060817
DFLSSSSFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:28329926-28338860
DFMCGGGKVASPPGPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:3307685-3309939
DFQKDDELQVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:21955529-21959722
DGEDDFMHELAEDGTPNESTMELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
DGLFSHK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:21607199-21616747
DGLSSGDDWLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
DKHGLLNVSEVELEPFRLQ http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:6243944-6244216
DLATSLEGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
DLDALPGSQTRPVELSGTPDQLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6979333-6984769
DLDSLNTLSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
DLETPSYELMDLPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:34944090-34948709
DLFAAPEKSPAEPNPVASK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:25526857-25534518
DLFEGLLQAGSTLVENLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
DLGAGVEFGDLHWLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
DLGAVNTLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21230453-21235121
DLGGVELLSQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
DLGVTDDLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:91459-96710
DLLLKEEASVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
DLLLVNLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
DLLSDSLSPVPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:5982912-5998864
DLLYKDFHTDQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:29770484-29773362
DLPVVMTFLLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
DLQDLLMECQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:33911351-33911802
DLSSPLDELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:19588487-19594579
DLVQLALVESNSAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:21607199-21616747
DLVTSAPLSPTTAVDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:21884809-21903793
DLYPQTEPYDFGFLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:25477309-25484544
DMADLVDPPTVTVAAGNTATTTTVPTAAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21595427-21597470
DMFFGLVER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:32478805-32479264
DMLGEEGELYSAEDADSAEYDGAPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:41067312-41073429
DMTMSPPGPHGVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
DNESYGEGTSLDGLGAGTLGDELK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:26597950-26601602
DNMASLMPPLTSSPPDVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:11586150-11589934
DNSLAESPECQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1341331-1343077
DNVTDLHASGVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
DPFVVATVTGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:34730945-34731442
DPPSTDNMSVLLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:25002748-25006618
DPQTLLPALLGLFCMN http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:4315060-4315297
DPSAGSPTETLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:5289-29980
DPTLAVVAYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
DRPSAEALPVFVQPVEYAGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:19710055-19733244
DSASVADFDTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:11668101-11672932
DSDVLLTNLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25461489-25467830
DSFLVNGVAFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
DSLDQLVAFFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22357695-22358132
DSPAAKYLLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
DSVNGGNPFGNPLQQGFSTGLFLEPNGYYQGNEADTRR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
DTALANDTLNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:410412-418150
DTGYVSDFAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4706863-4707510
DTNSEPEAQLELEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:7506173-7511293
DVAAMPDSPPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:24769906-24773362
DVAAMPDSPPRR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:24769906-24773362
DVALALLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:19851487-19859050
DVASDAAAHLLGGGPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21595427-21597470
DVDLYLWAPTAQDVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
DVEAVSQASSGSGATLGESLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
DVEFSEWK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
DVEMGFDLSHTKHR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:27694489-27698885
DVLEDLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
DVSDLEFFMFPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:19676987-19681726
DVSEDVHMATK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:25482145-25483060
DVYEFFSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:2923130-2931635
DWNNELQDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:37006375-37013554
DYSTALLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:15911513-15915657
DYSVALLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
EAADLDLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:27444456-27459271
EAELAVEEAPAATSEGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25461489-25467830
EAETVTVVS http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:18773613-18773932
EAFNAVQTSQSSDSVADEMDHDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
EAFTEDELEVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:11264268-11281448
EAKPYLEDGVHPHSLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
EALCQAVEEMHADMLVLGSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:30902126-30902819
EANFQLDSLLAEPLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:18669980-18692868
EAPKPSLGKPSSANTSSDSPVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:27582127-27598505
EAQDLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
EATGTSSADDTGYGDPVQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38055909-38057936
EATSGSGDEELEADKHGEEVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1276730-1286985
EATTPPASSSSPSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:18555024-18564366
EAVEEAGVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:33917184-33921231
ECGNPLHAGTNCAGYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:1543289-1543880
ECQDLQLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
ECSETETEDDAELLQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:30225162-30230157
EDAAAAMDNMDGAELFGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:22413908-22418499
EDAFFEAVTNLACEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
EDLAELAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:32062274-32069118
EDLNYVNAHATSTQMGDLKEFEALNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:16372638-16378600
EDVVPSESPLLAFTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
EEELSGDELEEFLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:25003071-25014552
EEELSGDELEEFLKDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:25003071-25014552
EEGELSPNGDVGENFGPFDGVSVDGVSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:39445-47162
EENKHNFEECQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
EEQTQAYLPTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
EEVFGPVAPLVPFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:4044614-4051886
EFAQDMEPEQLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:5891371-5891691
EFEEGCATPPAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:41305828-41314225
EFFASMVVDAVLALSNDDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
EFFLAGKPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
EFVTGSYDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:7679136-7685512
EGATSTPSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1882104-1882361
EGETAAELLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:18334633-18348718
EGGLLLTTYDLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:35454208-35459855
EGLLSALDDGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:4216829-4219748
EGLLSALDDGKSEGGPSGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:4216829-4219748
EGLPLFLLANWR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
EGPVGFGGQESPGGFGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:27998323-28004931
EGSAYENPQADR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:28768788-28771628
EGTTVDVTGSKEDDMEAEEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:8043785-8067221
EGVEVPQLVEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25045146-25046165
EGVVLFTGALAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
EKPSTPEEAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:6872052-6875396
ELAEDKVFDAASK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21595427-21597470
ELAETELSLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
ELAQGYCDSFAPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:13359938-13363123
ELATYADHLQLGLAGNLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
ELEEACEAEDFER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25593687-25596516
ELENAAASAQESLATVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:3091927-3092195
ELGGLLEDLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:30346035-30346364
ELGKGEEQHVNQEAADAAVVLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:25482145-25483060
ELGLETDDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29292718-29302740
ELGLETDDKTALSAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:29292718-29302740
ELKDEEVESFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:18145900-18154619
ELLGLPLAELER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:4443858-4448173
ELLLDSLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:17857774-17868440
ELLPLLEQTTQLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:36281081-36284814
ELLSCPMNQSAMVALTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:15630162-15630671
ELLTDEPFTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:5298102-5301438
ELLVALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:30259956-30261842
ELLVVANDLTFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
ELNGVWSVTVPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
ELQENAEQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:32370813-32374517
ELSGKPAEQVFVNSVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
ELSSDLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:26245751-26250944
ELSSLQQELLVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
ELVDAPLQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:4316739-4317867
ELVEELFADK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:410412-418150
ELVLESSSPPDDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:25070643-25077426
ELYATELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:15410405-15419017
EMSADQSGDSSLESPLLQQEMVTDPSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:5780907-5788967
EMVTLACDAATDDEGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:20778421-20786524
ENDTAAVSVSPVLESR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24292426-24299168
ENLLGFLVQVPPLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:16202476-16215470
ENLNNFEENDFQLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:21818774-21822028
ENLVALSDTEVPEQEAAAENK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:6227884-6232506
ENQYYLYEVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
EPAAAKPPPLGPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:14533270-14533823
EPPPVPALAPSPVVLPAPLVDPPPVAVHSPVSTTNLSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:27239554-27250573
EQAAHLNALSEYER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
EQCNQNLLLSLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:11025839-11038841
EQEEGNTGAAHSWK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:18967613-18970528
EQVDLLLSEVAGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:31623026-31629931
ESELLLLQETLASK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:32328176-32332787
ESFASAGQASFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
ESMELLETK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25593687-25596516
ESNFYDAEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
ESNFYDAEKTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
ESNSLTQGAVYPAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:27883441-27887877
ESSSSLSLGGDSMSPPQSSHVLSNDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:21943403-21957940
ETFTLTFVTGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11273881-11284496
ETPESEPPPTFLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:30961424-30965135
EVALESVPGPLLNTQSAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28091491-28102058
EVFSPCGELVDLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:23835253-23844980
EVLAVNQDALGLQGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:18707766-18711335
EVLDSPSVMTLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:33665002-33672565
EVLNDPCTPKPDPNPFTYVPEPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:16478156-16488672
EVSATGALVEGDAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:30902126-30902819
EWAPGAHSAALVGDFNNWNPNADR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19358703-19367059
EYDESDLAYLQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28639834-28641377
EYGLPVQFQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:21501179-21516492
EYLESLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:8043785-8067221
FALGTASSLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:2531640-2545324
FAVLLSGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22333338-22355015
FCFEVLAGEYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:11025839-11038841
FCSGHLVLNLHR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=Syng_TIGR_028:12286-25416
FDDAGSSMSGVAASK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21373525-21375411
FDGAAAAAGGGAASAPVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:15956482-15966179
FDLASVLCR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:17857774-17868440
FDLPFPLVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:31336061-31336303
FDLTLGGLTSTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22333338-22355015
FEAVLHFAGLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:29632086-29635463
FEPNVMCEHLDKK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:18334633-18348718
FESMSQNLVSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:12545960-12547865
FFDPEFFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:25477309-25484544
FFFAPGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26071308-26072170
FFHLNLYESK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:5411315-5413718
FFTFVGDLTQLQSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:10212234-10215571
FGFNHSAEGVTYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19358703-19367059
FGGAGFLELER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:27343416-27343759
FGLLLYSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:26933428-26950921
FGSFLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:23902573-23908618
FHLGDNLVFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:10508288-10508585
FHLGDTVVFTYNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22997320-23001715
FHPHGDSAVYETLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:34011253-34024926
FLAELENLQGTHSFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:23318072-23322052
FLELLELLQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:35790311-35804137
FLGEVVLQLDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:28173583-28176896
FLHPEGNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:25002748-25006618
FLHVLCGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22333338-22355015
FLLQLLQDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:26527635-26531630
FLNDKVTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13621875-13626289
FLPLEEMQNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:18145900-18154619
FLPTYLSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:18153473-18160108
FLQPVTNNEDSEGLSER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:3587993-3597147
FLQVPFPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
FLVDTFTSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
FNALLEELGLEQPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
FNNEHVNKDLDQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:24301684-24309652
FNRGDEMAVFAPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
FPGLLELDLSQSPSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:25514249-25517408
FPGSEMMGLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21324959-21327652
FPNLLLVEGLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:4831188-4834955
FPTKPAPPSQAVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:26464358-26466966
FQAFQLLAFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:15410405-15419017
FQALDTTQPTEMVTDHR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
FQVTGFSVGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:11025839-11038841
FSASSLDNASGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:24489118-24501888
FSASSLDNASGKK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:24489118-24501888
FSLDMSPVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:11668101-11672932
FSLVGVWHTNYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:17905144-17908763
FSNLELDLPAMMSQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:3526768-3529963
FSQEVPPTPGQPVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:28173583-28176896
FSVGGLADVAELK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:29292718-29302740
FSVSFDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:28347234-28347522
FSVSFDKER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:28347234-28347522
FTFLHAPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
FTWTLENLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:3412801-3424024
FVASEGEDFHLAEGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:26418925-26422579
FVCNPVTGQLFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:9182685-9185347
FVDDVELVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38800959-38815212
FVEFYGEGMGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
FVGVLNFFLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:23360602-23362329
FVSEAVSYLCEAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:25273660-25283257
FVSPSEVSVDLLDGGSTTVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:3526768-3529963
FVVAGDLGQTGWTESTLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:2432866-2436317
FYQGNPVYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:10610061-10615663
FYVDVERQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:6433813-6434415
GAACLRLEEYQTAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
GAAFGLAGVVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
GADPALVLNNLYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:34011253-34024926
GAEEALSHAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21595427-21597470
GAESEQPTAAAATAEQAQDLLDAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:27777638-27777941
GAGTDSDDGFDLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:26638181-26640772
GAGVLFEELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:2679343-2684135
GALLANYYQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:21315816-21321521
GANLMLGGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:4044614-4051886
GAVLALLDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:2834617-2840846
GDCVYTTVSHFNLLHYQCHQEAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
GDEMAVFAPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
GDLKADELMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
GDLLALAVTENDLVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
GEAAGDAGAAAAAKPEVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:2679343-2684135
GEALENLTQSVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:24531534-24540069
GEASPPPPPPPPVGPPGAAVVAAAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:19703631-19713255
GELVTHAQNLQQELQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25496392-25496983
GFDQELDYPMDQDHGDER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6062216-6066434
GFFDSSVPSTPMYNSSFSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:31013587-31021346
GFGFVTFSEPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4659842-4662494
GFLVELLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:32732569-32733326
GFMAQGGDFSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4175395-4181194
GFSDELPVFLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
GFSDTQLAFATSSSETDVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
GFTFTGYHV http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:26497673-26499403
GGAWVVVDSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11273881-11284496
GGGDAVPSANDDCFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4659842-4662494
GGGDFSSGGGGGYNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:3323168-3326941
GGGGGGDHPGPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12447443-12449763
GGPSTPMLVSSPSLNPVYSPPPSVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:26886559-26908313
GGVHDHVGGGFHR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:41067312-41073429
GGYMELTGFSAPVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:12968068-12973815
GHVLEVLVSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:410412-418150
GKLLQLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:8154214-8154445
GKTDLETLDVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:34011253-34024926
GLAVGWLGHPLFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:10876909-10877172
GLCLLSSSVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:9275374-9278919
GLFDYPLYGAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:110727-112210
GLFLLKNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:39960773-39975917
GLFVLDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12447443-12449763
GLGESVASVAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
GLGTATVTLQDLGLSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22521666-22535111
GLLDVLSGDLPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:27728863-27733712
GLLHDVGPEHSSGGGGGMGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:27458636-27459731
GLLLSVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
GLLVDCLVQLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
GLLVSFFSSAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:5289-29980
GLPAGTLHVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28091491-28102058
GLPNLLSPSYEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:8043785-8067221
GLQFLLGTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:26933428-26950921
GLQGSEAAELASEWVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:32370813-32374517
GLRPALNVGLSVSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4728370-4729899
GLSLSLSLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:9084393-9085064
GMDLYFQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:28173583-28176896
GMNSSKVMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:24618447-24618689
GNLQLVVQAAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
GNSLSGDGMLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:1338951-1339179
GNVLEPQGLLELK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
GPDPDLVGLVER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:23515654-23517254
GPEETLSVKR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:19609884-19622138
GPFVVNLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:13328664-13331717
GPLMYYTTEPVMSGGQGGVGVGYSGAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12447443-12449763
GPLWEEVSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:754652-755546
GPTHLESFSAKTYTGTSQGLPVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:21943403-21957940
GPVQLLTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:25033513-25041514
GQAGAAGLEAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25388707-25392420
GQASYSDAANVVEQTLGALK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28825679-28832429
GQCDDELLNVTNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
GQHLVEVNPQGLSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33569542-33572858
GQLGLQQVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:18669980-18692868
GQQAEAAAAALSGLATR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26962612-26970216
GQTASARVLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:23643673-23644224
GRPPPQQHRPSSGGGGGGGSGDLASSAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:5775039-5776229
GRPWPPAAVPDPWQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12447443-12449763
GSASFPHSSPLQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:23061268-23067749
GSDLDDSEDDEYSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:19517323-19524741
GSDSKFENAVLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
GSELGFSCEENPQHVELVDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:19425284-19427528
GSPEEEEEEE http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:12547813-12550271
GSPSAGDAGGDAPVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:28005411-28012430
GSSMNDAPSSDPQDSVQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
GSTGLLVVAQADVDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:23749418-23753207
GTLEQLEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:9122180-9123229
GTNECGLEEDVVAGMPSTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:14161674-14165216
GTSVLEMVAAFEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:29632086-29635463
GTTLELLRPDPETGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1978364-1982502
GTYSLYFSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:4216829-4219748
GVAVEDATSPYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:28093509-28093792
GVDESDLHR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
GVEDEVEVYEPASPPER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:26232860-26233357
GVEGVVANQGGAEGVAVSPDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:11867162-11874176
GVGAQGLELSETVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:27728863-27733712
GVLLVAAATHR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1978364-1982502
GVLMYLSQGNLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:3336207-3342883
GVTEKGSEQLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
GVYSQPDNLMGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:32062274-32069118
GWDWEEEHEGEWRPEEEEEGGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12447443-12449763
GWSAASGCCR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12447443-12449763
GYNEMKYTPSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
GYQFGMVAVFDSVEELDAVEGDGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25045146-25046165
GYSESHAATLGSVLVTNVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:6872052-6875396
HAASAPPPAPDASSPSSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22861798-22876171
HADLALYVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:32788545-32792599
HAQLPDEAKELDKELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:19601817-19607128
HASFEYGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:14850888-14853785
HDAVVLAPTNPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:28992811-29004564
HDFYNSATEVVLTLFAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
HDLDLLPGGDLTELGER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:31503273-31514332
HEAPADADGSRPPSPPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31096626-31101161
HFEVDLSAFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:13359938-13363123
HFSVNAYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:14161674-14165216
HGASLVEVYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:27239554-27250573
HGDVTEEELLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28825679-28832429
HGSYDKLDDDGLAPPGTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:25033513-25041514
HKNHVGPLHDLVNTATR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:144202-146093
HLTFYELDLGLNHVSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1978364-1982502
HNDDDENLNTDLTGNHSEPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25461489-25467830
HPQSVLAGFDPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12447443-12449763
HSASFDGFAFGAGAGGPGPGLGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:28780146-28783811
HSESPLTGMDLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:11236386-11243758
HSGFLAHYATLASR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:2679343-2684135
HSLVTAANR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
HVLNEQGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:21494126-21496669
HVVSLGAMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:3675798-3679138
HYAGYVGVGNGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:26287760-26292533
HYLVDTFHFL http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:11237212-11237731
KAAAAAAAPAAGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:26464358-26466966
KAPASPEQPLLAPLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22028326-22030758
KDDGQGDSVTVGGTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
KEEVPTVESEENESPQSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:29680896-29683226
KEQVLNESK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
KEYDESDLAYLQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28639834-28641377
KLDGQLGGLLSEASAEEDFTGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
KLDHNLAGSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:2398336-2399776
KLEEAVNAAVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:8800800-8805082
KLEEWSKLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:14702243-14702779
KLETEVESELVLAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25593687-25596516
KLLLSLAMSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:6496387-6496530
KLPLLYLAANSGAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
KMNEVDEESK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13621875-13626289
KNFMFLLLNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:30393954-30397061
KNLDNPQSSDLFNPHGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
KNPNLEVLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:24340876-24341244
KPVTVSTSSFLFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:90257-95420
KPWLAVGMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:13359938-13363123
KPYHGVNFVLAHDGFTLCDLVSYNLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:17857774-17868440
KQEGLLQEELQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1754864-1781910
KSPSLLDLLQMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:4371319-4376697
KSQQMRGENLNPSAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:33273967-33281023
KTFSYAGFEQQPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
KTGLQPQPQPQLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:26719280-26719555
KVEPETSSPLANDSQQDAAVGDVDDSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
KVPSLTENSSSSASSSFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:2531640-2545324
KVSQAYEDLDPQHSQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:410412-418150
KVVVETNGPHLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:42303783-42311180
KYNAPQPGADQFQMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6979333-6984769
KYQNLDLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:31560356-31560517
LAAAGLVGLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:5337495-5341120
LAAAGVHGNGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22521666-22535111
LAAEEEAASLLEHFAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25593687-25596516
LAASGLGLVLVGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:23241883-23244773
LADAAQSGNVAALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:2543928-2546275
LADEHDHPDTSLAESK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25461489-25467830
LADFGAALSGANK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:29292718-29302740
LADFGLASLFDPNKNQPMTSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13111319-13115734
LADLLGQLLASEENVER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:12365598-12374781
LADQLNAELVLGTLQNAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:410412-418150
LAEEGESAELTGSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:8043785-8067221
LAEELSEVPVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
LAEELSEVPVKK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
LAEGDLGSSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:7755032-7763790
LAELVEEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:34011253-34024926
LAEQDEDSREDEDAEADEER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1219276-1222725
LAFAGNPPQPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:4008085-4013311
LAFTNTVSLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:27167174-27167386
LAGCQSELDAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
LAGFAPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21230453-21235121
LALDGLGLSGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:42183901-42187392
LALEVAPTYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
LALGTLALEDALSTGSPLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:32370813-32374517
LALHNAGFLAQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=Syng_TIGR_028:12286-25416
LALNSPGFLNELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:2333183-2333452
LALQQYDVNALVDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24994741-25002852
LALRPSSPESLQQLLELAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:21884809-21903793
LALVPLTFGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:3388194-3399873
LANDGSGLGAALLAAAHSQYLN http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:5337495-5341120
LAPEQLVAVEGLHDLCR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22555812-22557590
LAQGSQNADTNTAASSQTVSVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
LAQYPGSLNFNVMALSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:27358148-27361057
LASHGLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:18744855-18745355
LATTATELVDVAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21230453-21235121
LAVGSLATALK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:25482145-25483060
LAWNLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:29819031-29820152
LCQVDSPDSPQPGGLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:8043785-8067221
LDADKVTETADFQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:22164885-22168640
LDAGGDDDDAGAGVGSLGSSGGGGGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6979333-6984769
LDCTLFSPLGDQDTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:8043785-8067221
LDDVEPEESDHGETGLDDQLPDTDNLSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:30629914-30635268
LDEHLDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13941691-13948830
LDFTESSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:27796339-27815927
LDGGDEGMLGFLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13293859-13309331
LDGKPAGNYLEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:5775039-5776229
LDGLYALFSVSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
LDGQLGGLLSEASAEEDFTGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
LDLDDPSAVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
LDLDDPSSVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11273881-11284496
LDLLDELASVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13293859-13309331
LDNALVQAVALLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:18669980-18692868
LDNLGNVLESR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:11624625-11625596
LDPTLLDLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
LDQDLYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:35790311-35804137
LDQPLLLTGFSALNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11273881-11284496
LDQPLLLTGYSALNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
LDTAQPAPDYAAAVAFLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25388707-25392420
LEAPVVLVTGASR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:18382978-18387808
LEASLQDVSAQLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:440483-446768
LEASPPRPEEPVADSSAAAAAAGAMGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:18116698-18121145
LEDLLLAEER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:31503273-31514332
LEEANGNTQSVLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:19011102-19013778
LEENDDHLSTEDTEETSNNTNLVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1624186-1629861
LEEYQTAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
LEGATFEMLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28091491-28102058
LEGEDKELYTEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:21230273-21235639
LEGNLAQAEDALMLDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13941691-13948830
LEHPDSLEQDKESEDELDAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:33363956-33370267
LELAQFAELQAFAQFASALDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:39117922-39118245
LELEPEHASLPDNVAEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
LENEELLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
LENHGLDPNVELVPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:23264501-23270644
LENSVYNFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:21955529-21959722
LESGQLLQCVVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:5537827-5556882
LETELASSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
LEVDLVNYLQSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:25350154-25361113
LFDQSDAYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:25033513-25041514
LFFQELVAVHDER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:3497336-3497608
LFLEEQLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:33170455-33179183
LFLGPLVPLPESR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:11342265-11348072
LFLQNVLGHP http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:25002230-25003170
LFMDFLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:12365598-12374781
LFNAAEAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6979333-6984769
LFNSDGSEPEMCGNGVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:23318072-23322052
LFNVVLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:32989795-32993615
LFPGFDSLMSHSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:1973999-1979220
LFQMDSMLNGYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19358703-19367059
LFSDALEALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:16372638-16378600
LFSPAFAAAASGSGDLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:24951173-24952023
LFVFMLGGATR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:1901519-1908928
LFVGGLSWDTTER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4659842-4662494
LFVLAVDCYGDDGSASK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
LFVVLGAGGAGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21230453-21235121
LGALGLLLETAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
LGFLLSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:12451511-12452182
LGMLNALEQLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
LGNYTEAVADANK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
LGQDLYLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22333338-22355015
LGQEPVLVYLDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22362500-22363016
LGQGEQELATDLDFSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:15410405-15419017
LGSECESLFDPLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:3219346-3222433
LGSFTLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:5769853-5772248
LGSVTNDVSGAVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:20666359-20673326
LGTSVLAHK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
LGTVTVQELPFFDTVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:29559810-29566365
LGVSAYGGGAVPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:21681917-21682764
LGWASLWVGDAGGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:6810996-6814991
LHNGHNDMDNLSEGGSMANDLNDAGELNNGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:11993942-12007508
LHSGLQNMVNNSPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22521666-22535111
LHTYDDVVER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:18334633-18348718
LKENPPSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:7755032-7763790
LKLGQPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:32672439-32678823
LKSNNVMLDVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:29770484-29773362
LKSYEDSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:5411315-5413718
LKSYEDSKSQLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:5411315-5413718
LLAEDTSTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:21230273-21235639
LLAEGDDRDVENR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:410412-418150
LLAEPWDCGGLYLVGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:17857774-17868440
LLALLGGPCTEGPGMLVSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:14014748-14022165
LLALSTVGTLSGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
LLATVASASATVYDCR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:23749418-23753207
LLCLSGPPGVGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:29292718-29302740
LLCPVTLAGGLLGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:14774951-14781580
LLCSLDASDNLGFGPYQAFFLGGGGGGGSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12447443-12449763
LLDGLLTEYESK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:28005411-28012430
LLDKYDLYGSVAFPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
LLDLLHPAAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
LLDVLNTPSEAVQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
LLEEGPVTVAPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
LLEFQDVVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:20109737-20116061
LLENNATSVAHFLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
LLESVPPVALSDDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:25091895-25097997
LLETSTPLTPVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:10633982-10639603
LLEVTYCPDCTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:4150735-4157231
LLFVDPSTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:5537827-5556882
LLGASLPALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
LLGEQYDALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:26883488-26887721
LLGHPAFDMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:28173583-28176896
LLGLAGDTNVQGEEQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:21494126-21496669
LLGLDNLLNLVVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:7755032-7763790
LLGNLLSDPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:14085549-14087759
LLHAAFVPFGELK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:22413908-22418499
LLHDDKGGTTLSNDGATLMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
LLHTLSVPGQLQFFFAPGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26071308-26072170
LLLDSNNNPEHFLTTNPFYDSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:234253-243999
LLLHWSTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:29941017-29945680
LLLLALER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:3364186-3373919
LLLLGSYSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5424842-5425245
LLLPNSLQGYVHNSVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:10209007-10209327
LLLPQNEANLAGTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:21884809-21903793
LLLQQVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:9091126-9207031
LLLQSFSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:17976724-17977224
LLLSPSLSSPTFSTSSPSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:19165796-19171821
LLLSQLSASR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:32769922-32772958
LLLSYTNLLPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:12106372-12109451
LLLYNMLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:20136187-20136447
LLLYRCR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21370559-21370823
LLLYYEPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:26626339-26626608
LLNLHAPEWSGEVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38055909-38057936
LLNLLFPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:11071961-11080691
LLNPTELLDPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:18145900-18154619
LLNSPKEETQAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:6401741-6411992
LLPHPLNQATNQPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:15923226-15923849
LLPVLLGFDPSLEVAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28684527-28698654
LLQALVENR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:29292718-29302740
LLQEQNNLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
LLQHTPDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:19609884-19622138
LLQQGQGLPKK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:34689941-34690387
LLQYDPAVAER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24994741-25002852
LLSADYSRPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:12804710-12809950
LLSGLQSDGDESR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:91459-96710
LLSLGPDDYEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25776340-25783461
LLSSGNVYTQEELLTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:18153473-18160108
LLSVNGLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:6810996-6814991
LLSYENVPPFLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:5710005-5732200
LLVDLAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
LLVDSQVEVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:11264268-11281448
LLVHVLGGEGGLESDNVAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:28699866-28705397
LLVPLLVLQNHNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:11071961-11080691
LLVQEGLYEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:4044614-4051886
LMKECDER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
LMLLSVLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:26933428-26950921
LMNHENAEVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:21818774-21822028
LMQCLYYNLLMNEVGMKSWEEYTEKDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:25156516-25157361
LMQFLFLLDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14946341-14955893
LMSGSPDSLPASVEAEENER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:10366901-10368043
LNEEPEVHADHTMDPDYESPEEQEQDTGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:20778421-20786524
LNEVNSSADLDLGVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40483658-40490062
LNGFTAELEHQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
LNHLVSCDQTEVLEPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:32328176-32332787
LNLGQAVSEGTVNNETLGYFLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:19676987-19681726
LNLSAHVQPLTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:410412-418150
LNLYYLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:29096970-29109563
LNQEQALALER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:32328176-32332787
LNSELLNNLGNFLNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:18145900-18154619
LNSVPVAEVPSLLSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:25003071-25014552
LNTYANFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19358703-19367059
LNVTPVEDKTSEEEPVTYANK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:19178864-19191229
LPADLLLNAEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:18669980-18692868
LPAEAAATATSGAMNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
LPAEAAATATSGAMNKYPLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
LPATFSVPDAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:1049242-1059479
LPDFACPYVFPLCK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:9952083-9953097
LPDVTELDVLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
LPGQGFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
LPGQGFKR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
LPGTELLPGDLVSLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:19609884-19622138
LPKPPATELLEQVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:18236024-18238051
LPLGDLQAASR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
LPLSSSPDAAEDNDNFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=Syng_TIGR_028:12286-25416
LPLVEPHAFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:2432866-2436317
LPNMLMDQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:17551534-17556429
LPPLNLQLLDLSGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22333338-22355015
LPSFPEYEVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21324959-21327652
LPSVFWLWR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:33518390-33518842
LPSVNEALVVPTQVNYVGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:32062274-32069118
LPVVVASQDVNLVAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:21654783-21661237
LPYLYNALVVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:20972801-20973037
LQASEDVDSVGYDSDGSER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:9267071-9281091
LQASPVVLSNGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22521666-22535111
LQDAQLCLDELTQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25461489-25467830
LQECEGLLLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25593687-25596516
LQEYPFLFAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:8629928-8634596
LQGLDGEATEPMLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
LQGLSDPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
LQLTDLLESVNEAER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:27622638-27636124
LQNGQALNLDLDLPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:2549935-2550182
LQPETEQRPHK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:15569110-15573458
LQQELEVLTQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:6581046-6587583
LQVVPLHLPPGDPATER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6979333-6984769
LQVVPLLASR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
LQYLLGLSDEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:18669980-18692868
LRDELQQKDEETSQQVEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:32370813-32374517
LRLDNALVQAVALLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:18669980-18692868
LSAAGLTHVHLLPSFHFASVDDNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
LSADTSSSAVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
LSAFTVDDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22361418-22362377
LSALPETLTASSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:3459418-3465533
LSAYGLTVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:410412-418150
LSDSLAALEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25593687-25596516
LSDSVSGLTVVDPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:19011102-19013778
LSELVENSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
LSETLGNLLDDGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25901862-25902734
LSGFALSTAMPLPETLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
LSGNLSGTDPLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21324959-21327652
LSGTLLQLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13293859-13309331
LSLQELSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25593687-25596516
LSLRMCLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:30790995-30791312
LSPFTASGAALK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4554567-4568278
LSSALEASLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:18669980-18692868
LSSNLTLTAMEVMLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:2127101-2127344
LSSSDESVASVSDSLLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22521666-22535111
LSTVLDDFPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4871360-4874638
LSVVRPVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:9868590-9868940
LSYEEEPLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
LTAAAALASGTVLGLHEDSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
LTDGLDGESDQPQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:25091895-25097997
LTDTSLETR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:5337495-5341120
LTEMVQEDPLTVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:29292718-29302740
LTFELFADVVPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4175395-4181194
LTGLTGLLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:725298-747641
LTGTQYASSLDVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:18253991-18258161
LTLGDALSLNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
LTLQYLLNLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:18892482-18892736
LTPDLVDELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:4550588-4559146
LTPEYLELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:17551534-17556429
LTSEDPDDGFKPTGGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
LTSGLSALAQPFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:91459-96710
LTSTQDVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:21818774-21822028
LTTVVPGTDESLAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:8417748-8422747
LTVVVGSMPSSGPTGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:5537827-5556882
LTWNAWPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:14014748-14022165
LVDADAAAAPAAGDAEGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:22763919-22768860
LVDAGGVAEPADVQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:19517145-19525503
LVDPLTVDLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:1653499-1661466
LVDSLQDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:2679343-2684135
LVDWLNATNGTAGAFDVTTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:29760864-29769639
LVEPLMSLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
LVEQLLGYLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:3403300-3432090
LVFSQQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:39701-40135
LVGSEGSPLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:4831188-4834955
LVLEDMCR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:29632086-29635463
LVLFDQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:25477309-25484544
LVLFLGNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:697818-708175
LVLLEAASR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22521666-22535111
LVLLEYSPDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1978364-1982502
LVLNPLSSLADLPLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:26933428-26950921
LVLTFEPATPFLVPLDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:26886559-26908313
LVNMVVNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:9091126-9207031
LVPLNLLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22123787-22134582
LVPPLLLSEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:1705381-1706871
LVQNDQFLDLVYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:2565166-2568200
LVQVVSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:34751494-34755599
LVQWPLFLLTSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:725298-747641
LVSEAGVGVVASGVVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28091491-28102058
LVSSLGEQELDSQQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
LVTEALLPLLLLSSSGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:26579985-26583414
LVTTNVTSHTCTVDLYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
LVYQVGALPTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:27590930-27596045
LVYVLNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1978364-1982502
LWGTSPDSLDAAEDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
LWLMVFGNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:20852594-20858228
LWPPPGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:17623362-17623751
LWSVLSQHFLAAGSHHEEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
LYDLVEEMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4652799-4658747
LYDTALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:3237854-3249804
LYEADAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26071308-26072170
LYETHVGMSSTEPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19358703-19367059
LYGSATDGVNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:1734130-1735209
LYKEDPAACAVVMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:18145900-18154619
LYMETELPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:14850888-14853785
LYNPEKEELCFVGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:18334633-18348718
LYTPAAVDLFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31501275-31512447
MAATAAAEHPFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
MANDTNAGLAAYLFTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:4044614-4051886
MASDNVGATSELHGAGQSFGQGSSSLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:2720449-2725927
MEEELLQDLQVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25593687-25596516
MEQYLQGQSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:23797462-23808338
METLFHFLLASLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:11264268-11281448
METPSGLKDSLPAWLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19358703-19367059
MFQLLVHCQEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21230453-21235121
MGALLASGLLDAGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:30799082-30802996
MGDLVHTLTNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19358703-19367059
MGLSTLASYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:27622638-27636124
MHLLQESGDDADR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
MLALSALNTLLQGSPDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:11264268-11281448
MLELFPVVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:26708668-26711921
MLFVLLGSSSSGLEMSLFFAF http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:30362520-30362674
MLLDMHGDTLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:13954391-13958270
MLLSYVDALPSGEEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:26418925-26422579
MLQVLQEVFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
MMALYVASHYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:3587993-3597147
MMPDCLTVTSNGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29190380-29190879
MMTLLDLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:26332868-26344993
MNAYVDLLNDLLSAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
MNDDSNCGGEYSQAGGLQDVSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:1043473-1043901
MNTDDGYGYGGGGGGGGTYSSGAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4659842-4662494
MPSQNLTEESNVAYEEPPVELPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:697818-708175
MQNGLVPNGEASNSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:21818774-21822028
MSDPHDEFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:41067312-41073429
MSKEELDSTYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
MSPEDFLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:7755032-7763790
MSSSLSEPEESFESEAFQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:26360284-26374568
MTGGGGGLGER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11439677-11440207
MTNFYTNFQVDELGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4728370-4729899
MTQEAFSNTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:3364186-3373919
MTSGDMALGSPVSSQGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
MVHAGQEVLLLSGSHALHQHEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:11071961-11080691
MVLLSVLQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
MYLDELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
NADVESDVESGELVPGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:30842711-30845773
NAEVDVTVAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:18145900-18154619
NAGEGLLPVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:19430458-19430716
NALGLDDVDAANMHMELGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:18669980-18692868
NALNNGLLVDPHDQHALADALLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
NALQELDTVASSGEVAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
NAYCLLNFGDSLTTDHLSPAGSLHK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
NCDNFQVNQNDVEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
NFASELMALLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:21655897-21664425
NFELMEEER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:17551534-17556429
NFLMEAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:234253-243999
NGEVHLNDPLAMAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28091491-28102058
NGGADDPDATSVER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:25399776-25403942
NGSAESALVNPLSLDGSDGSDKGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:2720449-2725927
NHGLSDLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:17067271-17070817
NKLEQLMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
NLAETENGDFDVSSDDALNELSVEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:22763919-22768860
NLANVVLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21324959-21327652
NLDNPQSSDLFNPHGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
NLESQETSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:10193546-10196396
NLGFTGVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:12331909-12335361
NLLAEAASDGNGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:19055902-19068071
NLLELDRER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:13359938-13363123
NLLPCRNPQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:15677280-15677516
NLLQNLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21578487-21579426
NLLTTLPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
NLPATAQVASQQGQYLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:2310371-2315159
NLPDPDAEVLALSPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:28409739-28411328
NLPEDVAFAESR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=Syng_TIGR_028:12286-25416
NLPLDGVSAQSLKPSASSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:18717472-18725462
NLSSEFEQWNTLVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:5780907-5788967
NLVGCSPSEDLNEDNSAQLADGDDLVGSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:8043785-8067221
NNGAEGLGLCR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:18153473-18160108
NPELVLQSLGYLLNTVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
NPESFLSSFSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26071308-26072170
NPESFLSSFSKGVQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26071308-26072170
NPFLLDDTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:19425284-19427528
NPLNLLPSFDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13941691-13948830
NPVYMMDTSPSSSQSFSVDPPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:39960773-39975917
NQNLFAGFSPDLLSEALSVSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
NQPSPPPQEEEEGNHGSAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:11411890-11415936
NSGDDTFLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22333338-22355015
NSKFFHLNLYESK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:5411315-5413718
NSLAQAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:4408071-4408453
NSNDTDALPACSLPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
NSTLADVLNDLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:21501179-21516492
NSTLSDVLTDLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:18334633-18348718
NTAAVVNELSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21324959-21327652
NTFLEADLQCSNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:28005411-28012430
NTLYVGGLAEEVDEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:22413908-22418499
NTSLDKEFLAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:28173583-28176896
NVANAGGDSVGDTLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:14404431-14416332
NVFDADSSLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40483658-40490062
NVTVWHVDTATALYQHYQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:23749418-23753207
NVYAFDPAQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:11000109-11005403
NYLDNGSTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:17551534-17556429
PALNVGLSVSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4728370-4729899
PDQLQGRK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:892239-930982
PFLFLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:34420019-34420291
PLLLVNLGGPTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19750089-19754683
PPSSFTLPWSGGKASAASLTHK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5654945-5655240
PYLEDGVHPHSLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
QALDQLFSSQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:29632086-29635463
QALLKER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:18140232-18143984
QDKGVLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26071308-26072170
QELAKCVEEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:28347234-28347522
QELLQNVAHDMGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:25482145-25483060
QEPGTAAAAAVAAAAGSPPAEDTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:18953889-18956711
QEPVDETVTDPLSGEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:5780907-5788967
QGKFPTLVTHQESLESK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:27930673-27965259
QGLSAAEGQNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33931853-33934108
QGSLHVNLPDQDPEDAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:24142817-24147458
QGVALALHSLADVLGSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
QLAAQLLPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:12365598-12374781
QLDVNTEVGVVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:25033513-25041514
QLEACGGQALTFGGDVSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:18382978-18387808
QLEHLDAER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:28005411-28012430
QLGVQLASADEQAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:14404431-14416332
QLHLSVLAVFNSWDSAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:18153473-18160108
QLLDQVVSTALPESK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
QLLEQPLFSGNLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
QLLLYEFLP http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:24003568-24004267
QLQAGAQGSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:12393814-12394233
QLQPTWLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
QLQQNLQMSVNFLVSLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:27930673-27965259
QLQTLQEVSGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:5780907-5788967
QLSAAGDAGQQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:6138453-6141366
QLSNSSDLTGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4554567-4568278
QLSVLTLAESTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:18253991-18258161
QLTASPSMSSTLSGLDLDSSPDLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:30565185-30582056
QLVLEVTSENR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6979333-6984769
QLVVLYAAVNGFCDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4728370-4729899
QMFAQVTNPPLDPLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:27622638-27636124
QMLMAETLEHR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:18153473-18160108
QMSVVQLEHAETMER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:3224656-3233830
QNELEPLQQSPPLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:9470727-9473856
QPGLVGLLETMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:27239554-27250573
QPLPTDDEMLALEYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:11061027-11076629
QPQYEPLPLEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4728370-4729899
QPVDGPELVDRMDSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:19838838-19845241
QQFSMTSLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:32826691-32831119
QQQLDNEMFLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:17551534-17556429
QQSEEPEEQVDLEGDDDNDVMDDDEDGYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:8101016-8105380
QQSEEPEEQVDLEGDDDNDVMDDDEDGYRR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:8101016-8105380
QRGEAAGDAGAAAAAKPEVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:2679343-2684135
QSALAADQVSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:36381009-36382889
QSDVPELYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
QSSLDLFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25776340-25783461
QTAAAVTQAPGEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
QTGFSLPLSQQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:27998323-28004931
QTVEATADDTEGTSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
QTVEATADDTEGTSKAEEPATGSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
QTWPELLGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:14897274-14897767
QVDLLGFGSGPEVDQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
QVLAAAVASDPAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:3471523-3473980
QVLLQSETLQELTSASK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
QVLSLCDHPALLDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25495638-25496147
QVQGEVPGSPLFLMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
QVTSNGGNQSVASSSGADYADGLVEDLSTKPGMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:23833326-23839720
QYLDPLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
RADLPAER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1978364-1982502
RAQAEAAGGGDKEAVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:1734130-1735209
RDEAAPPAPRQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13981871-13982374
RDPTLAVVAYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
REGFAWVSFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
RFPAAPTEGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
RGGGGEVEGVGNGEEAGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:21818480-21822056
RGSLLLLLASSGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26398984-26406514
RHEAPADADGSRPPSPPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31096626-31101161
RKYQNLDLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:31560356-31560517
RLLALSTVGTLSGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
RLTPPDFQPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:13201174-13205829
RPAVALVSTDGNWLTFMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12219890-12222933
RPDGSFLTDLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:21884809-21903793
RPGDAELVYAQTAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:29632086-29635463
RPLYTLDESDDDLPPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:4167577-4183658
RPQEPAFPSEDEDDFAGGEVAAPAPTEGLSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38055909-38057936
RPSGVAGGEVSLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:1446373-1448623
RPVTSQKLEAGEKK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:32384732-32395086
RQELLFGPPDGGGLEEGNLSAEER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:11000109-11005403
RRGAGSSPSAAAAVGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22157960-22159581
RTAEHLQSTLGSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:25482145-25483060
RVEAAEEAEKPSTTELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:18312284-18317615
RVLASSDCDTGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26988397-26995227
RVPEALVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38055909-38057936
RVPLSPQGSADHHNASDSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:9889450-9916204
RVSSLPQSTALPVLPTTTPAAEPSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:640962-644152
RVVCGLDGVEEEERR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:23242853-23243125
RYDDEEEPEQFGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:11668101-11672932
RYDVVDESGTDSGDEYDATDDGRR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:6152677-6153191
SAAAAAFLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:23318072-23322052
SAAAAAPVDEQTSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21595427-21597470
SAALTTMALALK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
SAALVGDFNNWNPNADR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19358703-19367059
SAASGSSSSSSSTQELAVAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1978364-1982502
SADLEGDLPFSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:9889450-9916204
SADLYELPSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:26933428-26950921
SADMFCDDLFGESPAGLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:27480876-27486557
SAGDCSETDSCASDTDGVELEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:11162774-11171682
SALDEVTDAGAFDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:12731912-12735907
SALQASLLSP http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:20568586-20574334
SAPDVEPLLYEDSPPSSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:26302261-26305492
SAQLWDEQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:24301684-24309652
SASAFSGQLAELER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:5082520-5085005
SASLLSQTLELPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:27494618-27508324
SAVLSSTQSFSGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:20778421-20786524
SCLSELGELSASFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:15139029-15143563
SDDPPAASDPSSPPPPPPPVAVAAATADPPPPAQPQGQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:6032308-6035055
SDGSFLEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:11025839-11038841
SDGVEESENGPTDEDNGVSDGENEDDLGADAEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:24411909-24426699
SDLDQYEGGLETFSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19358703-19367059
SDNTSTPVWNSEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:42303783-42311180
SEAASKPTVPSGNNSESGLPGTAAGASSTAAPAPSGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:91459-96710
SEEFVPGPLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
SEKEVEDVDAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:24301684-24309652
SELDGSESADPAPPSNALQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
SEPVGLGGGLQPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:18717472-18725462
SETHALYSSDALER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25495638-25496147
SEYGSTLDDDQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28312033-28316991
SFDFTNEER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:3388194-3399873
SFHDLAEHDLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26071308-26072170
SFLGMGYYNTHVPAVLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:29559810-29566365
SFNEKGGLTNER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4728370-4729899
SFPALAPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:12365598-12374781
SFPLSLVSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:7335094-7338927
SFSDEDWER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22358435-22358722
SFSHTLSLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:32624113-32646713
SGDLTVADVENLLNSYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:8629928-8634596
SGEGQLDLLLLDCLYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:26104742-26110909
SGETLKNLQLQSGAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6979333-6984769
SGGAAASAQLLDLLEDTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:24301684-24309652
SGGDNLPTLEKNDDSPLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:8043785-8067221
SGGGAPAASAPLGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
SGLGSSPQAPSPSNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:5982912-5998864
SGPSDYLLEEEEGLNDHNVVSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:4696813-4699159
SGTDGACLAEMDSALCSAQSCPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:1501124-1508005
SHGLGVFGNDAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:18145900-18154619
SHPLDPLSAAELAVALATVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:23830054-23836568
SHSLSNDLHGVQPDPVAADLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:16478156-16488672
SKLDLNENMLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:13017124-13017304
SKLTSTQDVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:21818774-21822028
SKNAEVDVTVAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:18145900-18154619
SLAAADQLDASGNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:30838946-30845361
SLAASSSSSTTTFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:14803310-14804025
SLDATEPPFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
SLDELTAMLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1754864-1781910
SLDSFEDPETK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:22763919-22768860
SLDSSDSPLSQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
SLEAESLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:32328176-32332787
SLEEEQLTAVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:9275374-9278919
SLEEKKELLAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
SLEGFYSPELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:3204231-3204674
SLEMMLHHLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:2266653-2270719
SLESLSMALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
SLFDSGPSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:31013587-31021346
SLGLQVSSPGYDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:3313744-3319873
SLLDNLDHQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
SLLDSNLEDGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28091491-28102058
SLLENSALTLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:35369120-35380639
SLLFGQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:11993942-12007508
SLLLYSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:34706884-34722374
SLLPLEQVGLTCFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:2834617-2840846
SLLPVEPLVDECEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
SLLPVEPLVDECEKR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
SLPMRDEEEDLDELER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:5523929-5530767
SLQSNGENNGVEPVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:23902573-23908618
SLREEDYLSNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:725298-747641
SLSCDSSTMEANAGDGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:23902573-23908618
SLSELEMFTEESK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
SLSLELPLFER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:14984774-14985406
SLSLFGDSAPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:12365598-12374781
SLSLSAGSKPNDPSAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:23820655-23825141
SLSLSGLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:35106346-35106900
SLSPAMAAALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:20653575-20656757
SLSPAPLPLPTAPSFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:42177931-42179691
SLSSLPSAFVLPTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:2584836-2605231
SLSYHLNHLFMELGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
SLTSDELK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
SLVDWEQAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
SLVYSSDGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38055909-38057936
SLYNLLQELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:7885953-7894298
SMAHLYSFGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:27682108-27685351
SMSSSTPNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:25596706-25597165
SMTGEQLQAPSSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:14186634-14195022
SNDLAQALVGVYAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
SNEPAASSDERTEMETDAEGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
SNEVNLLSVLDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22356835-22357429
SNNVMLDVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:29770484-29773362
SNQEELGSVLNLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
SNSGNLPALLPDQVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:18253991-18258161
SNSKFPFFQGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:7504084-7516842
SNSLSEETEDLRK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
SNSPEQLFLLEPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:30882258-30885618
SPAAAAAAVVPSPVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:23236039-23236803
SPALSPPPQAASFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:39014146-39017852
SPDELTGPYKDDPAPTSFVPAAGYHK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:17560939-17564607
SPEQVSAAVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:234253-243999
SPNAVQSNMELEFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
SPNAVQSNMELEFKR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
SPNPDTLAQETGALVNSGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
SPPSDGCGSVLLTLAFPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:31160606-31161274
SPSAADLLPADDLAAAAGPSAADAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12022062-12027463
SPSLLDLLQMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:4371319-4376697
SPSSGDPAEAADLAASAAAALASPAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:14915526-14923982
SPTGEVLFGGETMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:33569649-33852071
SPVSDGETQVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:18334633-18348718
SQAAGNPYAAELAAAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:4216829-4219748
SQAAGNPYAAELAAAKK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:4216829-4219748
SQDSEVGDGTTTVVLLAAEFLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
SQGALNYDQVFMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1341331-1343077
SQLGELFELDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:2495119-2496361
SQNLDLQLAELASK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:32328176-32332787
SQRCFLMQLTPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:9243374-9243796
SQVGSLFQVLNTQESPPTFFQTNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:5780907-5788967
SREDNFLDDSALEDDEEDDDDDDGGGRPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:5523929-5530767
SRMLSRTSSGNLESLSTGSGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:35435132-35435630
SRTMATDAAATAHSASAGCSAMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:9067835-9071357
SSAASSSSAAAPPPAPAPAPAMDPSPSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:91459-96710
SSALPSETDLVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:22763919-22768860
SSDPDTLLSMFNALK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
SSDVTLLSSGDDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22333338-22355015
SSEAYTFNHDSMAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:28173583-28176896
SSEQVQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:31120567-31121276
SSFDGLHGSLNSSAVAQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:11993942-12007508
SSFFVPSADTYAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:23241883-23244773
SSGLSSTVVPSGSRPSSSCSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4554567-4568278
SSGNSFGSGSLLPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
SSGSYQREDVVPSESPLLAFTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40101747-40107150
SSLALGQLQLSDSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4554567-4568278
SSPELTDPSVEGYSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:5780213-5789559
SSPGLFEQLVTGLTVACK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
SSPMAGDADTAELTPSAASPLSEGASEFSADKDAPGDGALSEGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13778446-13788246
SSSQDRLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:13263199-13263471
SSSSAAAATAGTTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:21355234-21359699
SSSVEQHEHLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40483658-40490062
SSTAPLQSLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:35179503-35179878
SSVAQARPPTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:27060321-27060715
SSVLEGTQHEEDSDQEDLDEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:14981771-14992404
SSWQQQSYSYQTEQLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
STAASVTPVRPGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:30614197-30616224
STAHAMLGFANDAFVGTGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:21230273-21235639
STAPPVSLSGDSPEAVLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:21763419-21765083
STLGSESASVLSTPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:5982912-5998864
STLSVVAEANEHNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11273881-11284496
STMEAALSEFNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
STSLYNLLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
STVALLAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:3587993-3597147
STYGDLKPGSLLPYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:10058032-10060817
SVAADSWSVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28312033-28316991
SVAAQLGDGLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:16478156-16488672
SVEAGGEPGGGGGGAWSTVSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:23805422-23810665
SVFDYSVPSTPLQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:31013587-31021346
SVGEAMALGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
SVGGNPNLGLEELLASVVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4382445-4391655
SVGGNPQVDLEELLAGVVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:33273967-33281023
SVHEPMQTGLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13404631-13404960
SVLDVTGLEFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:12365598-12374781
SVLEGLFSLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:39262819-39266384
SVNTVQPVSESTEEASSSAPVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:23902573-23908618
SVPSTAFVEDSDSEQDNTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:20832823-20837224
SVSFSASR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:16608757-16609574
SVSGPLSPLAPEVSLPNPTTGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:35717825-35730015
SVSVVLLSGGQGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38542751-38545630
SYCPYCR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:27151387-27153785
SYDQADYGTSSEDGYALASK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:25350154-25361113
SYDQVDFGNSSEDGYALTPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:24489118-24501888
SYEDSKSQLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:5411315-5413718
SYSTNLAFTPPEYMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:34944090-34948709
TAAAEVSTSSTTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
TAALATPFNFDEVDSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
TACSATYFSSDGSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:23749418-23753207
TAEHLQSTLGSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:25482145-25483060
TAGHLALEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
TAQALLDFNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11273881-11284496
TASYASGLSPESSLDDLTLPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:30565185-30582056
TCTLESTDGECSGSLAQEPSDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:26633834-26636814
TDAPLDDETALSTPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:25350154-25361113
TDLLQFLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:3336207-3342883
TDQFLDVLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28744047-28744295
TEATMSGGETPANLGQVFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:26888766-26896020
TEELWDSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22356835-22357429
TEGLTYSFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:27859492-27868317
TEMAAAEVEAGAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:571147-573853
TFLHFFLPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:20580763-20678004
TFSYAGFEQQPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
TFTNMDELLDDYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:13919858-13925115
TFVLDFAADGLAAGVEGLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:23241883-23244773
TGFSSAPPAASPPSGGAPASYNSVPPPPADELQLAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6979333-6984769
TGNASEAGVLQLYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38619498-38623839
TGPSFTEAAMGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:6032308-6035055
TGQLKEVER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
TGRYSPPSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4659842-4662494
TGVVATLAGGGGGDGPVVALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:8321861-8338031
THVTNEGTALVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:2834617-2840846
TLDNVGQDEATACTLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11273881-11284496
TLELVAGKPLLLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:25388707-25392420
TLFVPQYVDSNLLLFVQLGEVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12447443-12449763
TLGSPQPTLPDPPLPVPENKK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13941691-13948830
TLKLLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:16080278-16080980
TLKPLLSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:27694489-27698885
TLLCVPATAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21230453-21235121
TLLDGGTVLQYGAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:19909779-19913662
TLLFSTER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:19609884-19622138
TLLSHLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:32672439-32678823
TLLSVDVFGALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1978364-1982502
TLLYGGLFLYPADQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:21494126-21496669
TLPLEAESKEQELK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1754864-1781910
TLQAVFELEALLLTGHCK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:26933428-26950921
TLSEAPLEEVFTDSTYGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:24531534-24540069
TLSFLVQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
TLSLEKDSTLEDADKGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4175395-4181194
TLSSAGTEPTAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:25279755-25286349
TLTDTVLVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
TLYALPLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:28759885-28766904
TLYGVVDGGSSDEDESTSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:14404431-14416332
TMFGASGFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:28173583-28176896
TMNALSPYGSLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:5710005-5732200
TNDETLSESGPSNQGESVEMLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:21607199-21616747
TNTEFVEVLSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:23318072-23322052
TPLDQATQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:22413908-22418499
TPSLLDFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:4462053-4471727
TQDGLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:12869462-12873647
TQEKDADAMQVDNAAEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:30799082-30802996
TRSSPELTDPSVEGYSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:5780213-5789559
TRSVNTVQPVSESTEEASSSAPVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:23902573-23908618
TSRSVDVVLNDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:35193232-35194243
TSSPQQTEVCQALFQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:18145900-18154619
TSTTSSLPSSSER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:3811778-3812072
TTDVLDGFTDLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:2397130-2397764
TTMLETFTLPAGTENLMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:24056973-24057539
TTPSVVAYTKSGDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13621875-13626289
TTVANAATAAQTNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:29382705-29388041
TTYCHPLMVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:20868619-20872221
TTYCYDFPLAFETAVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
TTYRDTVGPLFGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:15630122-15631141
TVAFLLPALEVVSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:19517323-19524741
TVCNFSSGLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:3373096-3377541
TVDNDLALK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:234253-243999
TVDVVCLSDDEPEEH http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:195292-208179
TVEGSGAPSNGAAAPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:2923130-2931635
TVGLGAYLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
TVLSGVPEAVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:3675798-3679138
TVLVCLPSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:7574256-7574728
TVMSDLDHAASTLDAANTSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:15956482-15966179
TVTANTATVSDYVGYLTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
TVTDLMDLGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=Syng_TIGR_028:12286-25416
TVTLEQDNVNFAFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:11025839-11038841
TVTLVSLGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=Syng_TIGR_028:12286-25416
TVTPCNDPMLYASLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:26332868-26344993
TVVNNESSELLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:12731912-12735907
TVYLDGTQEQLETAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6979333-6984769
TWLVDLNSETLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
TYLGPMTPPLVER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
VAAAAADAAAGGGAAEER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:30614197-30616224
VAAATAAAGEAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25045146-25046165
VAALLADLAAASAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:4482615-4489129
VAASLYGAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:14506451-14509975
VAFQLLFSSLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:3586854-3608103
VAGAAAELLHAASQYGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:5775039-5776229
VAGGELSVHGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:3675798-3679138
VALHEKEELLEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:25482145-25483060
VAQVALLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:5758549-5759267
VASPPLYTLVPPAETGFLTGGSAMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:3743655-3749211
VATVVSANLPLQSTSPLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13293859-13309331
VAVEKKDEVATVSELVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25901862-25902734
VAVFAEGPAADEAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:20666359-20673326
VAVTDLVFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:5411315-5413718
VAVTNTLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:19676987-19681726
VAVVLGPASPAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:14774951-14781580
VCFYDGPAGPLLQTVQLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
VCSLCLPLFNNGLEECGLADVGQADDAGAEAHANPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:32387263-32387938
VDGNAYDLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22333338-22355015
VDNQLVATYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:19609884-19622138
VDSPSMLTFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:27494618-27508324
VDSSLTGNNSSSPLGYNVLYSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:19703631-19713255
VEAAPAAGAGAAANADSPTSVLEDELSECK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29306070-29326235
VEGATFEMLAQDALR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:27622638-27636124
VELSNPDAELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:18334633-18348718
VENGLQALQPSLQVEPVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
VENGLQALQPSLQVEPVKEEQTQAYLPTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:14991800-14993667
VEPLVNMGQLTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:13359938-13363123
VEQQPLPEELTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:41305828-41314225
VESHFDLELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:3364186-3373919
VETEAFQVLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:5523929-5530767
VFADHVVESSELTTGLTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:5523929-5530767
VFANAETTLSYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:18153473-18160108
VFDEDDDGSYDDDLAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:9267071-9281091
VFGFEEVAGHNVTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:20028922-20031297
VFGLVFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:32062274-32069118
VFLETPLQNTNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28091491-28102058
VFLEYADVDGATK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:27590930-27596045
VFLNPLNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:8679734-8679977
VFTTALQNMNQER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
VFVQHSER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:21230273-21235639
VGELAEGLAGVELGGER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:23805422-23810665
VGLLGLGQNAPSTTTACK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
VGLLLYVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:26933428-26950921
VGLLVESAEPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:28091491-28102058
VGLVLGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6979333-6984769
VGNGLEESTSQGPLLNEAAVQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:4044614-4051886
VGSAAQLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4728370-4729899
VGSAAQLKAMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4728370-4729899
VGWMHKDELVEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12447443-12449763
VGWSDDGSPER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
VHALPLSPNSVLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:858870-862658
VHDALVDALSLTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5811591-5816157
VKDLATSLEGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:28682312-28687092
VKDVSEDVHMATK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:25482145-25483060
VKEGVEVPQLVEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25045146-25046165
VLAELPAPVVNDTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:23833326-23839720
VLAVDDFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
VLCEGEWLSLNGSTGEVLLGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:18153473-18160108
VLCMGVAVGNLSMEEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:27930673-27965259
VLDLTYPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:27622638-27636124
VLEATCTGSVLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:9977561-9978130
VLEGLSDLRDESDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:34011253-34024926
VLENGAAAPLAAASLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:16478156-16488672
VLEQQEAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:13589467-13602915
VLETQVVLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4659842-4662494
VLETYLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
VLEVSQLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:26398942-26399838
VLFDDDCNPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:34944090-34948709
VLFPLFDHVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
VLGDLAVTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:27622638-27636124
VLGEEEKAAENVYLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22703461-22704919
VLGEEEKAAENVYLKK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22703461-22704919
VLGLEAVDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:21324959-21327652
VLGLLPQAPVLFSGSVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:31503273-31514332
VLGLQGGYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:2679343-2684135
VLHVDDLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:23318072-23322052
VLLEENLACGSEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
VLLKEMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
VLLLGGGPNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:21892671-21897592
VLLLGLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:12244582-12245718
VLLLLLLASR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:11264268-11281448
VLLNAVASNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
VLLQQQWK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:23125476-23125783
VLLSAGADPTAQDDPHCR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:19055902-19068071
VLNLSGVQLLGLNNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:13954391-13958270
VLPYDQLMQELDVSNVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:18253991-18258161
VLQDAGASLLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:22555812-22557590
VLQPENEYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
VLQVLLACVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:13144940-13149564
VLSSEVANTTGMQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40483658-40490062
VLTAGSGVTLPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:13941691-13948830
VLTDFVASAVGLATPVAYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:22672523-22674894
VLTVNYAFPER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:22413908-22418499
VLVSHALTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:24907332-24908916
VLYHEDPNSPDAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:21955529-21959722
VMDLQVFAVNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:1907986-1908587
VMGGGTLLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:9634695-9634843
VMPLDLFGTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
VMSAASPASPTSPSTPAPAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33569542-33572858
VNESSTVPNMYLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1219276-1222725
VNLATGDAVPETR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:27728863-27733712
VNMLLDNLPVVVPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:21955529-21959722
VNPGNAPLVVGQLLDDECPEDFLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
VNVEGLTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:23241883-23244773
VPAQPDALNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:10508288-10508585
VPLSPQGSADHHNASDSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:9889450-9916204
VPSAGKLDLTTTVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22672038-22677309
VPSSVDVASLVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
VPYTSGLGLNALGVETDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:3526768-3529963
VPYTSGLGLNALGVETDKGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:3526768-3529963
VQAERPPWYLSVVGGALYK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
VQAPTSALTFLVSALAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:39000654-39002456
VQDAAASLFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:12925652-12925967
VQFELEQQQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:40483658-40490062
VQLVQFGLLSPDELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:3224656-3233830
VQNELLAQYATPLLEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:2834617-2840846
VQNQHERHENSQLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:31900826-31903814
VQQLFDLLPFSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:11273881-11284496
VQSLSDLEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:8629928-8634596
VSDGLAENLSLSEAWSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:2495119-2496361
VSDVAER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:21595427-21597470
VSEQSLDECK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:32062274-32069118
VSGEDVLLGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:25033513-25041514
VSGGLDLDTVNLLQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:22635207-22645819
VSGSADLYQVNER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:17857774-17868440
VSGVHTLYYEQSGNPQGHPVVFLHGGPGAGTSPGNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:25477309-25484544
VSQVLAGGGAEAVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:20359857-20366476
VSSLPQSTALPVLPTTTPAAEPSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:640962-644152
VSSSYDASSQTFSLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:28173583-28176896
VSVSDGTVTLVAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:24531534-24540069
VTFLPLNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:1754864-1781910
VTLHGTDAELYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:38055909-38057936
VTMLGLVPSLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:12817046-12821354
VTSLFGAER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:3205849-3206431
VTSLLDQLLQLSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:29248936-29271980
VTVKQPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:5437358-5437942
VVALPPAGSPTFSA http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:11272607-11285927
VVANLGASDLDAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:2600403-2602916
VVCPRQTNHHHHLLAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:3286757-3287485
VVDLVLSHQSVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13064616-13076578
VVEELAAEQKPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19358703-19367059
VVESEGGHVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12447443-12449763
VVETQTSLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:37006375-37013554
VVGGGGGGGGGCGDDASENGGDVSPVVAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:19276462-19281093
VVGKYCEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
VVGLDLGTTNSAVAAMEGGKPTLVTNAEGAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=5:13621875-13626289
VVLSCAGPFR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:24341146-24345714
VVPEVAEEEESGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:25901862-25902734
VVQATGHCGAALPTAPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:110727-112210
VVSDQSNLDPSSNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:13687144-13702026
VVSNDVSTASQGTSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4554567-4568278
VVTTAGLLDDSPLSPSTPSPSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:6519408-6522470
VVTVDGLLLTK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=12:27519009-27529630
VVVQSLPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:7032748-7032834
VVVTGLGAVTPLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:5422480-5426349
VVVVGGGLAGSLLAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:2776513-2777704
VVYVADYCK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:33911351-33911802
VWSLGSPDPNFTLDGHSK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6127179-6140220
VYGLNELQAGEMVEFASGVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:4728370-4729899
VYHPSTSQVEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
VYLFLTQLGLDKDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:19676987-19681726
VYLLANR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:10638242-10640694
WFALQATSDLPGNVANVQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:28173583-28176896
WGSLGSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:7767692-7768339
WGSTAFHNMLVVPPGSGLVHQVNLEYLGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
WTAPYPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12219890-12222933
WTLHLLNR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:16202476-16215470
YAKPEDAGVTPEDK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:16180808-16184655
YANDLSSGVLFGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:33779672-33782716
YAPGLELLSVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:17551534-17556429
YAYVAEVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:25033513-25041514
YDDGDLAFFDTVVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:21783297-21785989
YDLSLPVEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:4652799-4658747
YDLVDLTR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:33170455-33179183
YDVCGLVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:11025839-11038841
YDVVDESGTDSGDEYDATDDGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:6152677-6153191
YEGLYSAFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:410412-418150
YESSEVLLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=Syng_TIGR_023:10586-18961
YEYGWWEPFLPPK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12219890-12222933
YFLQAEQQLSDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:19710055-19733244
YFQGSFENLAK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:13954391-13958270
YGLTLDWVTQGLVQGMWEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:35261967-35262812
YGMDEYLELK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:4044614-4051886
YGNPTTEALEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:14850888-14853785
YGVSTQDAAFK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:18669980-18692868
YHLYVSYACPWASR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:12731912-12735907
YKSEGHDTLVLAGAEYGSGSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
YKVPGLLK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:18587333-18587915
YLCLKPSWR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:26090798-26092683
YLEAAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
YLEGYVQK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:254635-256475
YLLLDEAQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:749125-759315
YLLPTLER http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:3336207-3342883
YLLQSGLQEYLNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
YLNESEGGGVSLPSGGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:3219346-3222433
YNAPQPGADQFQMK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:6979333-6984769
YNELNDQNK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:31009418-31033489
YNFCYALCLDFSSSR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:19430124-19430406
YPDVPSFLVYLR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=7:3412801-3424024
YPQDLQVLHELVR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:3219346-3222433
YQLPVVVLVFNNNGVYGGDR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:17560939-17564607
YQNNKPSTPMR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:35297494-35301856
YQQAMGMAVECR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:30799082-30802996
YQVLSTKVELR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:24937617-24942572
YQWDQGYFQQELYR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=9:2495119-2496361
YRENQYYLYEVK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=4:4405660-4418567
YRSPSAADLLPADDLAAAAGPSAADAAR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=3:12022062-12027463
YSMPLALAGR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=6:23805422-23810665
YSPSHAYSPSSPR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:3224656-3233830
YSSSQGSGTGGGEGGGYVNGGGAGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=10:16608170-16608442
YSVQAAGELPYNGLYYDPPEEEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=2:19358703-19367059
YTLDLPTNVSELRPGQDLTVTTDNGK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=8:5327815-5334976
YVGPAQQSSLSQR http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=11:26553436-26563364
YVVEEVPDDAEK http://plants.ensembl.org/Oryza_sativa/Location/View?reattach=user;r=1:22774948-22782219